Quick Answer
FOXO4-DRI is a synthetic D-retro-inverso senolytic peptide that selectively eliminates senescent cells by disrupting the FOXO4-p53 interaction that keeps them alive, triggering apoptosis while sparing healthy cells. It was first described by Peter de Keizer and colleagues at Erasmus University Medical Center in a landmark 2017 Cell publication but remains entirely preclinical with no human clinical trials, no FDA approval and no legal pathway for prescription or compounding in the United States.
FDA Status
Not Approved
Compounding
Not Available
Human Trials
None (0 registered)
WADA Status
Not Listed
Evidence Level
Preclinical Only
Approach
Senolytic
What Is FOXO4-DRI?
FOXO4-DRI is a synthetic peptide of approximately 43 amino acids designed to selectively induce programmed cell death (apoptosis) in senescent cells – damaged, non-dividing cells that accumulate with age and secrete inflammatory factors collectively known as the senescence-associated secretory phenotype (SASP). It was first described in a 2017 Cell publication (PMID 28340339) by Marjolein Baar, Peter de Keizer and colleagues at Erasmus University Medical Center in Rotterdam.
The “DRI” stands for D-retro-inverso, a peptide engineering strategy where all amino acids are replaced with their mirror-image D-amino acid forms and the sequence is reversed. This modification preserves the three-dimensional surface topology needed for biological binding activity while making the peptide highly resistant to proteolytic degradation by mammalian enzymes. The compound also incorporates an HIV-TAT-derived cell-penetrating peptide sequence (RRRQRRKKRG) at its C-terminus, enabling efficient cellular uptake.
FOXO4-DRI represents a fundamentally different approach to ageing from every other compound in the longevity peptide cluster. Where epitalon targets telomere maintenance, MOTS-c and SS-31 target mitochondrial function, and pinealon targets neuroprotection, FOXO4-DRI targets the elimination of accumulated cellular damage rather than the preservation or restoration of healthy cellular function.
The bottom line: FOXO4-DRI is a rationally designed senolytic peptide engineered to kill senescent “zombie cells” while sparing healthy tissue, representing a clearance-based rather than repair-based approach to ageing.
How FOXO4-DRI Works: The FOXO4-p53 Disruption
Senescent cells should die by apoptosis, but they evade this fate through a survival mechanism involving the transcription factor FOXO4 and the tumour suppressor p53. In senescent cells, FOXO4 expression is elevated, and FOXO4 sequesters p53 within the nucleus by direct protein-protein interaction. This traps p53 in the nucleus and prevents it from translocating to mitochondria, where it would normally activate the apoptotic cascade.
FOXO4-DRI works by mimicking the portion of the FOXO4 protein that binds p53. When administered, it competes with endogenous FOXO4 for p53 binding and disrupts the sequestration complex. The freed p53 is excluded from the nucleus and redirected to mitochondria, where it activates the p53/BCL-2/Caspase-3 apoptotic signalling pathway. The cell undergoes programmed death.
The selectivity claim rests on the observation that healthy, dividing cells do not rely on elevated FOXO4-p53 interaction for survival. Because the FOXO4-p53 sequestration mechanism is specifically upregulated in senescent cells, FOXO4-DRI preferentially affects senescent cells while leaving healthy cells largely unaffected. Peter de Keizer publicly estimated this selectivity at approximately 10:1 (senescent to healthy cells), with his company Cleara Biotech developing next-generation compounds targeting 100:1 selectivity.
This mechanism differs fundamentally from small-molecule senolytics like dasatinib plus quercetin (D+Q), which target broader pro-survival pathways including BCL-2/BCL-xL, PI3K/AKT and p21. FOXO4-DRI’s approach is more molecularly targeted but comes with the manufacturing complexity and cost inherent to longer peptides.
The bottom line: FOXO4-DRI exploits a survival mechanism that senescent cells depend on but healthy cells do not, enabling selective elimination of damaged cells through a targeted protein-protein interaction.
What the Research Shows
All published FOXO4-DRI efficacy data comes from in vitro cell studies and animal models. No human clinical trials have been registered or completed as of 2026. However, the preclinical evidence spans multiple independent research groups and tissue types, which distinguishes it from some other peptides in the longevity space.
The Baar 2017 Cell Study
The foundational study by Baar, Brandt, Putavet, Klein, Derks, Bourber, Stryber and de Keizer, titled “Targeted apoptosis of senescent cells restores tissue homeostasis in response to chemotoxicity and aging,” demonstrated FOXO4-DRI’s effects in two mouse models:
- Progeroid mice (XpdTTD/TTD): These mice accumulate senescent cells in an accelerated fashion due to a DNA repair deficiency. FOXO4-DRI treatment restored fitness metrics (grip strength, running speed), improved hair density and enhanced kidney function histology. Median lifespan was extended by approximately 24.8% in fast-ageing progeroid mice.
- Naturally aged mice with chemotherapy-induced senescence: Doxorubicin treatment induced senescent cell accumulation. FOXO4-DRI treatment reversed liver toxicity and accelerated recovery of physical function compared to untreated controls.
The companion commentary by Krimpenfort and Berns in the same Cell issue framed the work as evidence that “therapeutic elimination of senescent cells” could achieve functional rejuvenation.
Testosterone and Leydig Cell Senescence
A 2020 study by Zhang, Xie, Chen, Lv and colleagues at Sun Yat-sen University, published in Aging, demonstrated that FOXO4 is specifically expressed in human Leydig cells (testosterone-producing cells in the testes) and that its nuclear translocation in elderly males correlates with decreased testosterone synthesis. FOXO4-DRI treatment selectively induced apoptosis in senescent Leydig cells and, in naturally aged mice, improved the testicular microenvironment and alleviated age-related testosterone secretion insufficiency. This represents an independent replication of the FOXO4-DRI senolytic mechanism in a tissue-specific context by a Chinese research group with no direct affiliation to de Keizer’s laboratory.
Chondrocyte Senescence
A 2021 study by Huang, He, Makarcyzk and Lin at the University of Pittsburgh, published in Frontiers in Bioengineering and Biotechnology, tested FOXO4-DRI on in vitro expanded human chondrocytes (relevant to autologous chondrocyte implantation procedures). FOXO4-DRI removed more than half of the cells at high passage levels (PDL9, representing senescent cells) without significantly affecting cell numbers at low passage (PDL3, healthy cells), demonstrating selectivity for senescent chondrocytes.
Endothelial Cell Senescence and Vascular Ageing
A 2025 study demonstrated that FOXO4-DRI alleviates endothelial cell senescence by activating the p53/BCL-2/Caspase-3 signalling pathway, improving vascular function and delaying vascular ageing in both naturally aged and progeroid model mice. The study confirmed that FOXO4-DRI functions through the same core mechanism across vascular endothelial tissue as originally demonstrated in the 2017 Baar study.
| Study | Model | Key Finding | Evidence Tier |
|---|---|---|---|
| Baar et al. 2017, Cell | Progeroid (XpdTTD/TTD) and aged mice | Restored fur, renal function, fitness; +24.8% median lifespan in progeroid mice | Preclinical (animal) |
| Zhang et al. 2020, Aging | Aged mice (Leydig cells) | Cleared senescent Leydig cells, improved testosterone secretion | Preclinical (animal) |
| Huang et al. 2021, Front Bioeng | Human chondrocytes (in vitro) | Removed 50%+ senescent chondrocytes, spared healthy cells | Preclinical (cell, human) |
| Le et al. 2021, EBioMedicine | Senescent cancer cells | Designed improved FOXO4-p53 disrupting variants for cancer senescence | Preclinical (cell) |
| Endothelial study 2025 | Aged mice, OGD endothelial cells | Improved aortic function, p53/BCL-2/Caspase-3 pathway confirmed | Preclinical (animal + cell) |
The bottom line: FOXO4-DRI’s senolytic mechanism has been demonstrated across at least nine tissue types and conditions by multiple independent research groups, but all evidence remains preclinical with no human clinical trials registered.
The Manufacturing Problem: Why FOXO4-DRI Is Hard to Make
FOXO4-DRI is substantially more expensive to manufacture than short-chain peptides because it requires solid-phase synthesis of 43 D-amino acid residues – mirror-image forms not found in nature that cost significantly more than standard L-amino acids. The published sequence is LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (with a cell-penetrating TAT sequence appended), and every residue is a D-amino acid.
Standard solid-phase peptide synthesis (SPPS) achieves approximately 90-99% coupling efficiency per residue. Even at an optimistic 99% per coupling, a 43-residue peptide yields only 0.9943 = approximately 65% crude product before purification. At a more realistic 95% per coupling, yields drop to 0.9543 = approximately 11%. The problem compounds further because D-amino acids are synthetic (not found in nature in abundance) and cost substantially more than their L-amino acid counterparts. The combination of low synthetic yields and expensive starting materials makes FOXO4-DRI fundamentally more expensive to produce than short peptides like BPC-157 (15 residues) or even MOTS-c (16 residues).
Reputable research-chemical vendors typically charge $200 or more per 10 mg vial. Certificates of analysis for FOXO4-DRI are rarer than for simpler peptides, and third-party verification of sequence identity is the only reliable way to confirm that a purchased product is the actual compound rather than a truncated or substituted sequence. Unusually cheap products should be treated with extreme scepticism.
The manufacturing cost problem is not merely academic. If FOXO4-DRI or a next-generation FOXO4-p53 disruptor were to enter clinical trials, the cost of goods would significantly exceed that of small-molecule senolytics like dasatinib and quercetin (both cheap generics). This is one reason Cleara Biotech is developing optimised analogues with potentially shorter sequences and improved pharmaceutical properties.
The bottom line: FOXO4-DRI’s length, all-D-amino-acid composition and resulting manufacturing complexity create a cost barrier that distinguishes it from simpler peptides and favours the development of next-generation analogues with more pharmaceutical-friendly properties.
FOXO4-DRI vs Small-Molecule Senolytics
FOXO4-DRI is not the only senolytic approach under investigation. Several small-molecule senolytics have advanced further toward clinical use, and the comparison is informative about both the advantages and limitations of the peptide approach.
| Compound | Type | Mechanism | Clinical Stage | Selectivity |
|---|---|---|---|---|
| FOXO4-DRI | Peptide (D-retro-inverso) | FOXO4-p53 interaction disruption | Preclinical only | ~10:1 (estimated) |
| Dasatinib + Quercetin (D+Q) | Small molecules (combination) | Broad pro-survival pathway inhibition (BCL-2, PI3K, tyrosine kinase) | Phase 1/2 human trials | Lower (broader mechanism) |
| Navitoclax (ABT-263) | Small molecule | BCL-2/BCL-xL inhibition | Phase 1/2 human trials (cancer context) | Low (thrombocytopenia risk) |
| Fisetin | Natural flavonoid | Multiple pathways (PI3K/AKT, NF-kB) | Phase 2 human trials | Moderate |
FOXO4-DRI’s advantage is mechanistic precision: it targets a protein-protein interaction specific to the senescent state. Its disadvantage is that it remains preclinical while D+Q and fisetin have entered human trials. A 2022 Nature Medicine review of the senolytic clinical landscape noted this gap – the most targeted mechanism is the furthest from clinical validation.
The bottom line: FOXO4-DRI is more molecularly targeted than small-molecule senolytics but trails them significantly in clinical development, with dasatinib plus quercetin and fisetin already in early human trials.
Cleara Biotech and Next-Generation Development
Cleara Biotech, a Dutch biotechnology company founded by Peter de Keizer to commercialise the FOXO4-p53 disruption mechanism, remains a preclinical-stage concern. Rather than advancing FOXO4-DRI itself into clinical trials, Cleara is developing next-generation compounds (designated CL04177 and CL04183) that target the same FOXO4-p53 interaction with improved selectivity and pharmaceutical properties. De Keizer has publicly stated the goal is to achieve an order-of-magnitude improvement in the senescent-to-healthy selectivity ratio.
The company’s current focus is on identifying specific clinical indications – potentially chronic obstructive pulmonary disease (COPD), osteoarthritis or kidney disease – where senescent cell clearance could demonstrate the clearest therapeutic benefit. No IND filing or clinical trial initiation has been announced.
The bottom line: The FOXO4-p53 disruption platform is being developed commercially by Cleara Biotech, but through next-generation compounds rather than FOXO4-DRI itself, and remains in preclinical stages.
Regulatory Status
FOXO4-DRI is not approved by the FDA for any medical use and is not available through any licensed prescriber or compounding pharmacy in the United States. It is a research-only compound. Products sold as “FOXO4-DRI” online are typically labelled “for research use only” and have not been evaluated by the FDA for safety, efficacy or purity. The compound is not a controlled substance in most jurisdictions. See our guides to peptide legality in the US, UK and Australia for broader context. The Category 1 vs Category 2 framework and the RFK reclassification tracker do not apply to FOXO4-DRI, which was never nominated for the 503A Bulks List.
The bottom line: FOXO4-DRI has no legal pathway for prescription, compounding or therapeutic use in any country and should be understood as an early-stage research compound.
Safety and Side Effects
No human safety data exists for FOXO4-DRI. In published mouse studies, subcutaneous injections (typically 25 mg/kg, administered periodically) did not produce overt toxicity. The progeroid mice in the Baar 2017 study showed functional improvements without reported adverse effects. However, mouse tolerability data cannot be extrapolated to human safety profiles.
A fundamental open question is whether eliminating senescent cells is always beneficial. Senescent cells play physiological roles in wound healing, tissue remodelling and tumour suppression. Removing them indiscriminately – or at the wrong time – could theoretically impair these processes. The Baar 2017 study addressed this concern by noting that treated mice did not show wound healing deficits, but longer-term studies in diverse physiological contexts have not been completed. For guidance on evaluating peptide purity, see our guide on how to read a certificate of analysis.
The selectivity between senescent and healthy cells, while favourable in vitro, has not been characterised in human tissues. The estimated ratio from cell culture data suggests a meaningful fraction of healthy cells may also be affected. In vivo selectivity in human tissues remains unknown, and the real-world therapeutic index cannot be assumed from preclinical models.
The bottom line: No human safety data exists for FOXO4-DRI, and while animal studies have not shown overt toxicity, the therapeutic index and long-term consequences of senescent cell clearance in humans remain entirely unknown.
Related Compounds
Within the longevity cluster, FOXO4-DRI is the only senolytic compound. All other compounds in the cluster – epitalon (telomere maintenance), MOTS-c (AMPK activation), SS-31 (cardiolipin stabilisation), pinealon (neuroprotection) – work by supporting or restoring cellular function rather than eliminating damaged cells. The senolytic approach is complementary in principle: clear the cells that are actively harming tissue, then support the remaining cells with restorative interventions.
Cleara Biotech’s next-generation compounds CL04177 and CL04183 represent the direct lineage from FOXO4-DRI, targeting the same mechanism with improved selectivity. The Le et al. 2021 EBioMedicine study and the Tripathi et al. 2021 EBioMedicine study independently designed novel FOXO4-p53-disrupting peptide variants, demonstrating that the Baar mechanism has generated a broader design platform beyond the original compound.
FOXO4-DRI demonstrated that rationally designed peptides can selectively eliminate senescent cells in aged animals, but the gap between preclinical proof-of-concept and human medicine remains unbridged.
Medical disclaimer: FOXO4-DRI is not approved by the FDA, MHRA, TGA or any other regulatory body for any use. No human clinical trials have been conducted. No safety, efficacy or purity data from human subjects exists. Products sold online as FOXO4-DRI have not been evaluated by any regulatory agency. This page is for educational and research purposes only and does not constitute medical advice or an endorsement of self-experimentation.
Frequently Asked Questions
What is FOXO4-DRI?
FOXO4-DRI is a synthetic senolytic peptide of approximately 43 amino acids, engineered using D-retro-inverso technology for protease resistance. It selectively induces apoptosis in senescent cells by disrupting the FOXO4-p53 protein interaction that keeps them alive, while sparing healthy cells. It was developed by Peter de Keizer and colleagues at Erasmus University Medical Center and published in Cell in 2017.
Has FOXO4-DRI been tested in humans?
No. As of 2026, no human clinical trials have been registered or completed for FOXO4-DRI. All efficacy and safety data comes from cell culture and animal studies. The compound’s developer, Cleara Biotech, is focusing on next-generation compounds (CL04177/CL04183) rather than advancing FOXO4-DRI itself into clinical trials.
Is FOXO4-DRI FDA-approved or available through compounding?
No. FOXO4-DRI is not FDA-approved, not available through compounding pharmacies, and has no legal pathway for prescription in the United States. It is classified as a research chemical and sold only for research purposes.
How does FOXO4-DRI compare to dasatinib plus quercetin?
Both are senolytics but use different mechanisms. Dasatinib plus quercetin (D+Q) inhibit broader pro-survival pathways including BCL-2, PI3K and tyrosine kinases, affecting both senescent and some non-senescent cells. FOXO4-DRI targets the FOXO4-p53 interaction specifically upregulated in senescent cells, offering higher theoretical selectivity. However, D+Q has entered early human clinical trials while FOXO4-DRI remains entirely preclinical.
What does “D-retro-inverso” mean?
D-retro-inverso (DRI) is a peptide engineering technique where all natural L-amino acids are replaced with their mirror-image D-amino acids and the sequence order is reversed. This preserves the three-dimensional surface topology needed for target binding while making the peptide resistant to enzymatic degradation, giving it a significantly longer biological half-life than conventional L-peptides.
Why do senescent cells depend on FOXO4 to survive?
Senescent cells – damaged cells that stop dividing but resist programmed death – upregulate FOXO4 expression as a survival strategy. FOXO4 sequesters the tumour suppressor p53 in the nucleus, preventing p53 from translocating to mitochondria where it would trigger apoptosis. This FOXO4-p53 interaction is the specific vulnerability that FOXO4-DRI exploits. Healthy dividing cells do not depend on this mechanism, which is why FOXO4-DRI shows preferential activity against senescent cells in preclinical models.
Can FOXO4-DRI be legally obtained?
FOXO4-DRI is sold by research chemical suppliers as a “research use only” compound. It is not a controlled substance, not scheduled by the DEA, and not individually named on WADA’s Prohibited List. However, it is not available through any legitimate prescriber or compounding pharmacy, and products sold online have not been evaluated for identity, purity or sterility by any regulatory body. The 43-amino-acid all-D sequence is expensive and difficult to synthesise, making verification of product authenticity particularly important.